# Licensed to the Apache Software Foundation (ASF) under one or more # contributor license agreements. See the NOTICE file distributed with # this work for additional information regarding copyright ownership. # The ASF licenses this file to You under the Apache License, Version 2.0 # (the "License"); you may not use this file except in compliance with # the License. You may obtain a copy of the License at # # http://www.apache.org/licenses/LICENSE-2.0 # # Unless required by applicable law or agreed to in writing, software # distributed under the License is distributed on an "AS IS" BASIS, # WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. # See the License for the specific language governing permissions and # limitations under the License. # Default localized string information # Localized this the Default Locale as is en_US jsp.error.compiler=No Java compiler available jsp.error.no.scratch.dir=The JSP engine is not configured with a scratch dir.\ \n Please add \"jsp.initparams=scratchdir=\" \ \n in the servlets.properties file for this context. jsp.error.bad.scratch.dir=The scratchDir you specified: {0} is unusable. jsp.message.scratch.dir.is=Scratch dir for the JSP engine is: {0} jsp.message.parent_class_loader_is=Parent class loader is: {0} jsp.message.dont.modify.servlets=IMPORTANT: Do not modify the generated servlets jsp.error.unavailable=JSP has been marked unavailable jsp.error.usebean.duplicate=useBean: Duplicate bean name: {0} jsp.error.invalid.scope=Illegal value of \'scope\' attribute: {0} (must be one of \"page\", \"request\", \"session\", or \"application\") jsp.error.classname=Can't determine classname from .class file jsp.error.outputfolder=No output folder jsp.error.data.file.write=Error while writing data file jsp.error.page.conflict.contenttype=Page directive: illegal to have multiple occurrences of 'contentType' with different values (old: {0}, new: {1}) jsp.error.page.conflict.session=Page directive: illegal to have multiple occurrences of 'session' with different values (old: {0}, new: {1}) jsp.error.page.invalid.session=Page directive: invalid value for session jsp.error.page.conflict.buffer=Page directive: illegal to have multiple occurrences of 'buffer' with different values (old: {0}, new: {1}) jsp.error.page.invalid.buffer=Page directive: invalid value for buffer jsp.error.page.conflict.autoflush=Page directive: illegal to have multiple occurrences of 'autoFlush' with different values (old: {0}, new: {1}) jsp.error.page.invalid.import=Page directive: invalid value for import jsp.error.page.conflict.isthreadsafe=Page directive: illegal to have multiple occurrences of 'isThreadSafe' with different values (old: {0}, new: {1}) jsp.error.page.invalid.isthreadsafe=Page directive: invalid value for isThreadSafe jsp.error.page.conflict.info=Page directive: illegal to have multiple occurrences of 'info' with different values (old: {0}, new: {1}) jsp.error.page.invalid.info=Page directive: invalid value for info jsp.error.page.conflict.iserrorpage=Page directive: illegal to have multiple occurrences of 'isErrorPage' with different values (old: {0}, new: {1}) jsp.error.page.invalid.iserrorpage=Page directive: invalid value for isErrorPage jsp.error.page.conflict.errorpage=Page directive: illegal to have multiple occurrences of 'errorPage' with different values (old: {0}, new: {1}) jsp.error.page.conflict.language=Page directive: illegal to have multiple occurrences of 'language' with different values (old: {0}, new: {1}) jsp.error.tag.conflict.language=Tag directive: illegal to have multiple occurrences of 'language' with different values (old: {0}, new: {1}) jsp.error.page.language.nonjava=Page directive: invalid language attribute jsp.error.tag.language.nonjava=Tag directive: invalid language attribute jsp.error.page.conflict.extends=Page directive: illegal to have multiple occurrences of 'extends' with different values (old: {0}, new: {1}) jsp.error.page.conflict.iselignored=Page directive: illegal to have multiple occurrences of 'isELIgnored' with different values (old: {0}, new: {1}) jsp.error.tag.conflict.iselignored=Tag directive: illegal to have multiple occurrences of 'isELIgnored' with different values (old: {0}, new: {1}) jsp.error.page.invalid.iselignored=Page directive: invalid value for isELIgnored jsp.error.tag.invalid.iselignored=Tag directive: invalid value for isELIgnored jsp.error.page.multi.pageencoding=Page directive must not have multiple occurrences of pageencoding jsp.error.tag.conflict.attr=Tag directive: illegal to have multiple occurrences of the attribute \"{0}\" with different values (old: {1}, new: {2}) jsp.error.tag.multi.pageencoding=Tag directive must not have multiple occurrences of pageencoding jsp.error.include.exception=Unable to include {0} jsp.error.stream.close.failed=Failed to close stream jsp.error.stream.closed=Stream closed jsp.error.invalid.directive=Invalid directive jsp.error.invalid.implicit=Invalid implicit TLD for tag file at {0} jsp.error.invalid.implicit.version=Invalid JSP version defined in implicit TLD for tag file at {0} jsp.error.invalid.version=Invalid JSP version defined for tag file at {0} jsp.error.directive.istagfile={0} directive cannot be used in a tag file jsp.error.directive.isnottagfile={0} directive can only be used in a tag file jsp.error.action.istagfile={0} action cannot be used in a tag file jsp.error.action.isnottagfile={0} action can be used in tag files only jsp.error.unterminated=Unterminated {0} tag jsp.error.loadclass.taghandler=Unable to load tag handler class \"{0}\" for tag \"{1}\" jsp.error.unable.compile=Unable to compile class for JSP jsp.error.unable.load=Unable to load class for JSP jsp.error.mandatory.attribute={0}: Mandatory attribute {1} missing jsp.error.flush=Exception occurred when flushing data jsp.engine.info=Jasper JSP 2.3 Engine jsp.error.invalid.expression="{0}" contains invalid expression(s): {1} jsp.error.invalid.attribute={0} has invalid attribute: {1} jsp.error.file.cannot.read=Cannot read file: {0} jsp.error.file.already.registered=Recursive include of file {0} jsp.error.file.not.registered=file {0} not seen in include jsp.error.quotes.unterminated=Unterminated quotes jsp.error.attr.quoted=Attribute value should be quoted jsp.error.beans.nullbean=Attempted a bean operation on a null object. jsp.error.beans.nobeaninfo=No BeanInfo for the bean of type ''{0}'' could be found, the class likely does not exist. jsp.error.beans.nomethod=Cannot find a method to read property ''{0}'' in a bean of type ''{1}'' jsp.error.beans.nomethod.setproperty=Can''t find a method to write property ''{0}'' of type ''{1}'' in a bean of type ''{2}'' jsp.error.beans.noproperty=Cannot find any information on property ''{0}'' in a bean of type ''{1}'' jsp.error.beans.property.conversion=Unable to convert string \"{0}\" to class \"{1}\" for attribute \"{2}\": {3} jsp.error.beans.propertyeditor.notregistered=Property Editor not registered with the PropertyEditorManager jsp.error.beans.setproperty.noindexset=Cannot set indexed property jsp.error.include.tag=Invalid jsp:include tag jsp.error.attempt_to_clear_flushed_buffer=Error: Attempt to clear a buffer that's already been flushed jsp.error.overflow=Error: JSP Buffer overflow jsp.error.paramexpected=Expecting \"jsp:param\" standard action with \"name\" and \"value\" attributes jsp.error.param.invalidUse=The jsp:param action must not be used outside the jsp:include, jsp:forward, or jsp:params elements jsp.error.params.invalidUse=jsp:params must be a direct child of jsp:plugin jsp.error.fallback.invalidUse=jsp:fallback must be a direct child of jsp:plugin jsp.error.namedAttribute.invalidUse=jsp:attribute must be the subelement of a standard or custom action jsp.error.jspbody.invalidUse=jsp:body must be the subelement of a standard or custom action jsp.error.params.emptyBody=jsp:params must contain at least one nested jsp:param jsp.error.plugin.notype=type not declared in jsp:plugin jsp.error.plugin.badtype=Illegal value for 'type' attribute in jsp:plugin: must be 'bean' or 'applet' jsp.error.plugin.nocode=code not declared in jsp:plugin jsp.error.ise_on_clear=Illegal to clear() when buffer size == 0 jsp.error.javac=Javac exception jsp.error.javac.env=Environment: jsp.error.compilation=Error compiling file: {0} {1} jsp.error.undeclared_namespace=A custom tag was encountered with an undeclared namespace [{0}] jsp.warning.keepgen=Warning: Invalid value for the initParam keepgenerated. Will use the default value of \"false\" jsp.warning.xpoweredBy=Warning: Invalid value for the initParam xpoweredBy. Will use the default value of \"false\" jsp.warning.enablePooling=Warning: Invalid value for the initParam enablePooling. Will use the default value of \"true\" jsp.warning.mappedFile=Warning: Invalid value for the initParam mappedFile. Will use the default value of \"false\" jsp.warning.classDebugInfo=Warning: Invalid value for the initParam classdebuginfo. Will use the default value of \"false\" jsp.warning.checkInterval=Warning: Invalid value for the initParam checkInterval. Will use the default value of \"300\" seconds jsp.warning.modificationTestInterval=Warning: Invalid value for the initParam modificationTestInterval. Will use the default value of \"4\" seconds jsp.warning.recompileOnFail=Warning: Invalid value for the initParam recompileOnFail. Will use the default value of \"false\" jsp.warning.development=Warning: Invalid value for the initParam development. Will use the default value of \"true\" jsp.warning.fork=Warning: Invalid value for the initParam fork. Will use the default value of \"true\" jsp.warning.dumpSmap=Warning: Invalid value for the initParam dumpSmap. Will use the default value of \"false\" jsp.warning.genchararray=Warning: Invalid value for the initParam genStringAsCharArray. Will use the default value of \"false\" jsp.warning.suppressSmap=Warning: Invalid value for the initParam suppressSmap. Will use the default value of \"false\" jsp.warning.displaySourceFragment=Warning: Invalid value for the initParam displaySourceFragment. Will use the default value of \"true\" jsp.warning.maxLoadedJsps=Warning: Invalid value for the initParam maxLoadedJsps. Will use the default value of \"-1\" jsp.warning.jspIdleTimeout=Warning: Invalid value for the initParam jspIdleTimeout. Will use the default value of \"-1\" jsp.warning.strictQuoteEscaping=Warning: Invalid value for the initParam strictQuoteEscaping. Will use the default value of \"true\" jsp.warning.quoteAttributeEL=Warning: Invalid value for the initParam quoteAttributeEL. Will use the default value of \"false\" jsp.warning.unknown.element.in.taglib=Unknown element ({0}) in taglib jsp.warning.unknown.element.in.tag=Unknown element ({0}) in tag jsp.warning.unknown.element.in.tagfile=Unknown element ({0}) in tag-file jsp.warning.unknown.element.in.attribute=Unknown element ({0}) in attribute jsp.warning.unknown.element.in.variable=Unknown element ({0}) in variable jsp.warning.unknown.element.in.validator=Unknown element ({0}) in validator jsp.warning.unknown.element.in.initParam=Unknown element ({0}) in validator's init-param jsp.warning.unknown.element.in.function=Unknown element ({0}) in function jsp.error.teiclass.instantiation=Failed to load or instantiate TagExtraInfo class: {0} jsp.error.non_null_tei_and_var_subelems=Tag {0} has one or more variable subelements and a TagExtraInfo class that returns one or more VariableInfo jsp.error.parse.error.in.TLD=Parse Error in the tag library descriptor: {0} jsp.error.file.not.found=File [{0}] not found jsp.error.missing_attribute=According to the TLD or the tag file, attribute {0} is mandatory for tag {1} jsp.error.bad_attribute=Attribute {0} invalid for tag {1} according to TLD jsp.error.tld.unable_to_get_jar=Unable to get JAR resource \"{0}\" containing TLD: {1} jsp.error.tld.missing_jar=Missing JAR resource \"{0}\" containing TLD jsp.error.unable.to_find_method=Unable to find setter method for attribute: {0} jsp.error.bad_tag=No tag \"{0}\" defined in tag library imported with prefix \"{1}\" jsp.error.xml.bad_tag=No tag \"{0}\" defined in tag library associated with uri \"{1}\" jsp.warning.compiler.classfile.delete.fail=Failed to delete generated class file [{0}] jsp.warning.compiler.classfile.delete.fail.unknown=Failed to delete generated class file(s) jsp.warning.compiler.javafile.delete.fail=Failed to delete generated Java file [{0}] jsp.error.jspc.uriroot_not_dir=The -uriroot option must specify a pre-existing directory jsp.error.jspc.missingTarget=Missing target: Must specify -webapp or -uriroot, or one or more JSP pages jsp.error.jspc.no_uriroot=The uriroot is not specified and cannot be located with the specified JSP file(s) jspc.implicit.uriRoot=uriRoot implicitly set to "{0}" jspc.usage=Usage: jspc [--] \n\ where jsp files is\n\ \ -webapp A directory containing a web-app, whose JSP pages\n\ \ will be processed recursively\n\ or any number of\n\ \ A file to be parsed as a JSP page\n\ where options include:\n\ \ -help Print this help message\n\ \ -v Verbose mode\n\ \ -d Output Directory (default -Djava.io.tmpdir)\n\ \ -l Outputs the name of the JSP page upon failure\n\ \ -s Outputs the name of the JSP page upon success\n\ \ -p Name of target package (default org.apache.jsp)\n\ \ -c Name of target class name (only applies to first JSP page)\n\ \ -mapped Generates separate write() calls for each HTML line in the JSP\n\ \ -die[#] Generates an error return code (#) on fatal errors (default 1)\n\ \ -uribase The uri directory compilations should be relative to\n\ \ (default "/")\n\ \ -uriroot Same as -webapp\n\ \ -compile Compiles generated servlets\n\ \ -webinc Creates a partial servlet mappings in the file\n\ \ -webxml Creates a complete web.xml in the file\n\ \ -webxmlencoding Set the encoding charset used to read and write the web.xml\n\ \ file (default is platform default encoding)\n\ \ -addwebxmlmappings Merge generated web.xml fragment into the web.xml file of the\n\ \ web-app, whose JSP pages we are processing\n\ \ -ieplugin Java Plugin classid for Internet Explorer\n\ \ -classpath Overrides java.class.path system property\n\ \ -xpoweredBy Add X-Powered-By response header\n\ \ -trimSpaces Trim spaces in template text between actions, directives\n\ \ -javaEncoding Set the encoding charset for Java classes (default UTF-8)\n\ \ -source Set the -source argument to the compiler (default 1.8)\n\ \ -target Set the -target argument to the compiler (default 1.8)\n\ jspc.webxml.header=\n\ \n\ \n\ \n\ \n\ \n jspc.webxml.footer=\n\ \n\ \n jspc.webinc.header=\n\ \n jspc.webinc.footer=\n\ \n jspc.webinc.insertEnd= jspc.webinc.insertStart= jspc.error.generalException=ERROR-the file ''{0}'' generated the following general exception: jspc.error.fileDoesNotExist=The file argument ''{0}'' does not exist jspc.delete.fail=Failed to delete file [{0}] jspc.error.invalidWebXml=Aborting pre-compilation due to errors in web.xml jspc.error.invalidFragment=Aborting pre-compilation due to errors in web fragments jsp.error.library.invalid=JSP page is invalid according to library {0}: {1} jsp.error.tlvclass.instantiation=Failed to load or instantiate TagLibraryValidator class: {0} jsp.error.tlv.invalid.page=Validation error messages from TagLibraryValidator for {0} in {1} jsp.error.tei.invalid.attributes=Validation error messages from TagExtraInfo for {0} jsp.error.no.more.content=End of content reached while more parsing required: tag nesting error? jsp.error.parse.xml=XML parsing error on file {0} jsp.error.parse.xml.line=XML parsing error on file {0}: (line {1}, col {2}) jsp.error.parse.xml.scripting.invalid.body=Body of {0} element must not contain any XML elements jsp.error.internal.tldinit=Unable to initialize TldLocationsCache: {0} jsp.error.internal.filenotfound=Internal Error: File {0} not found jsp.error.parse.xml.invalidPublicId=Invalid PUBLIC ID: {0} jsp.error.unsupported.encoding=Unsupported encoding: {0} jsp.error.taglibDirective.absUriCannotBeResolved=The absolute uri: {0} cannot be resolved in either web.xml or the jar files deployed with this application jsp.error.taglibDirective.uriInvalid=The URI provided for a tag library [{0}] is not a valid URI jsp.error.taglibDirective.missing.location=Neither \'uri\' nor \'tagdir\' attribute specified jsp.error.taglibDirective.both_uri_and_tagdir=Both \'uri\' and \'tagdir\' attributes specified jsp.error.invalid.tagdir=Tag file directory {0} does not start with \"/WEB-INF/tags\" #jspx.error.templateDataNotInJspCdata=Validation Error: Element <{0}> cannot have template data. Template data must be encapsulated within a <jsp:cdata> element. [JSP1.2 PFD section 5.1.9]\nTemplate data in error: {1} #Error while processing taglib jar file {0}: {1} jsp.error.needAlternateJavaEncoding=Default java encoding {0} is invalid on your java platform. An alternate can be specified via the 'javaEncoding' parameter of JspServlet. #Error when compiling, used for jsp line number error messages jsp.error.single.line.number=An error occurred at line: {0} in the jsp file: {1} jsp.error.java.line.number=An error occurred at line: [{0}] in the generated java file: [{1}] jsp.error.location=line: {0}, column: {1} jsp.error.corresponding.servlet=Generated servlet error:\n jsp.error.jspbody.required=Must use jsp:body to specify tag body for {0} if jsp:attribute is used. jsp.error.jspbody.emptybody.only=The {0} tag can only have jsp:attribute in its body. jsp.error.no.scriptlets=Scripting elements ( <%!, <jsp:declaration, <%=, <jsp:expression, <%, <jsp:scriptlet ) are disallowed here. jsp.error.tld.fn.invalid.signature=Invalid syntax for function signature in TLD. Tag Library: {0}, Function: {1} jsp.error.tld.fn.duplicate.name=Duplicate function name {0} in tag library {1} jsp.error.tld.fn.invalid.signature.parenexpected=Invalid syntax for function signature in TLD. Parenthesis '(' expected. Tag Library: {0}, Function: {1}. jsp.error.tld.mandatory.element.missing=Mandatory TLD element {0} missing or empty in TLD {1} jsp.error.dynamic.attributes.not.implemented=The {0} tag declares that it accepts dynamic attributes but does not implement the required interface jsp.error.attribute.noequal=equal symbol expected jsp.error.attribute.noquote=quote symbol expected jsp.error.attribute.unterminated=attribute value for [{0}] is not properly terminated jsp.error.attribute.noescape=Attribute value {0} is quoted with {1} which must be escaped when used within the value jsp.error.attribute.nowhitespace=The JSP specification requires that an attribute name is preceded by whitespace jsp.error.attribute.duplicate=Attribute qualified names must be unique within an element jsp.error.missing.tagInfo=TagInfo object for {0} is missing from TLD jsp.error.deferredmethodsignaturewithoutdeferredmethod=Cannot specify a method signature if 'deferredMethod' is not 'true' jsp.error.deferredvaluetypewithoutdeferredvalue=Cannot specify a value type if 'deferredValue' is not 'true' jsp.error.deferredmethodandvalue='deferredValue' and 'deferredMethod' cannot be both 'true' jsp.error.fragmentwithtype=Cannot specify both 'fragment' and 'type' attributes. If 'fragment' is present, 'type' is fixed as 'javax.servlet.jsp.tagext.JspFragment' jsp.error.var_and_varReader=Only one of \'var\' or \'varReader\' may be specified jsp.error.missing_var_or_varReader=Missing \'var\' or \'varReader\' attribute jsp.warning.bad.urlpattern.propertygroup=Bad value {0} in the url-pattern subelement in web.xml jsp.error.literal_with_void=A literal value was specified for attribute {0} that is defined as a deferred method with a return type of void. JSP.2.3.4 does not permit literal values in this case jsp.error.unknown_attribute_type=Unknown attribute type ({1}) for attribute {0}. jsp.error.coerce_to_type=Cannot coerce value ({2}) to type ({1}) for attribute {0}. jsp.error.jspelement.missing.name=Mandatory XML-style \'name\' attribute missing jsp.error.could.not.add.taglibraries=Could not add one or more tag libraries. jsp.error.duplicate.name.jspattribute=The attribute {0} specified in the standard or custom action also appears as the value of the name attribute in the enclosed jsp:attribute jsp.error.not.in.template={0} not allowed in a template text body. jsp.error.badStandardAction=Invalid standard action jsp.error.xml.badStandardAction=Invalid standard action: {0} jsp.error.tagdirective.badbodycontent=Invalid body-content ({0}) in tag directive jsp.error.simpletag.badbodycontent=The TLD for the class {0} specifies an invalid body-content (JSP) for a SimpleTag. jsp.error.config_pagedir_encoding_mismatch=Page-encoding specified in jsp-property-group ({0}) is different from that specified in page directive ({1}) jsp.error.prolog_pagedir_encoding_mismatch=Page-encoding specified in XML prolog ({0}) is different from that specified in page directive ({1}) jsp.error.prolog_config_encoding_mismatch=Page-encoding specified in XML prolog ({0}) is different from that specified in jsp-property-group ({1}) jsp.error.attribute.custom.non_rt_with_expr=According to TLD or attribute directive in tag file, attribute {0} does not accept any expressions jsp.error.attribute.standard.non_rt_with_expr=The {0} attribute of the {1} standard action does not accept any expressions jsp.error.attribute.deferredmix=Cannot use both ${} and #{} EL expressions in the same attribute value jsp.error.scripting.variable.missing_name=Unable to determine scripting variable name from attribute {0} jasper.error.emptybodycontent.nonempty=According to TLD, tag {0} must be empty, but is not jsp.error.tagfile.nameNotUnique=The value of {0} and the value of {1} in line {2} are the same. jsp.error.tagfile.nameFrom.noAttribute=Cannot find an attribute directive with a name attribute with a value \"{0}\", the value of this name-from-attribute attribute. jsp.error.tagfile.nameFrom.badAttribute=The attribute directive (declared in line {1} and whose name attribute is \"{0}\", the value of this name-from-attribute attribute) must be of type java.lang.String, is \"required\" and not a \"rtexprvalue\". jsp.error.page.noSession=Cannot access session scope in page that does not participate in any session jsp.error.usebean.noSession=Illegal for useBean to use session scope when JSP page declares (via page directive) that it does not participate in sessions jsp.error.xml.encodingByteOrderUnsupported = Given byte order for encoding \"{0}\" is not supported. jsp.error.xml.encodingDeclInvalid = Invalid encoding name \"{0}\". jsp.error.xml.encodingDeclRequired = The encoding declaration is required in the text declaration. jsp.error.xml.morePseudoAttributes = more pseudo attributes is expected. jsp.error.xml.noMorePseudoAttributes = no more pseudo attributes is allowed. jsp.error.xml.versionInfoRequired = The version is required in the XML declaration. jsp.error.xml.xmlDeclUnterminated = The XML declaration must end with \"?>\". jsp.error.xml.reservedPITarget = The processing instruction target matching \"[xX][mM][lL]\" is not allowed. jsp.error.xml.spaceRequiredInPI = White space is required between the processing instruction target and data. jsp.error.xml.invalidCharInContent = An invalid XML character (Unicode: 0x{0}) was found in the element content of the document. jsp.error.xml.spaceRequiredBeforeStandalone = White space is required before the encoding pseudo attribute in the XML declaration. jsp.error.xml.sdDeclInvalid = The standalone document declaration value must be \"yes\" or \"no\", not \"{0}\". jsp.error.xml.invalidCharInPI = An invalid XML character (Unicode: 0x{0}) was found in the processing instruction. jsp.error.xml.versionNotSupported = XML version \"{0}\" is not supported, only XML 1.0 is supported. jsp.error.xml.pseudoAttrNameExpected = a pseudo attribute name is expected. jsp.error.xml.expectedByte = Expected byte {0} of {1}-byte UTF-8 sequence. jsp.error.xml.invalidByte = Invalid byte {0} of {1}-byte UTF-8 sequence. jsp.error.xml.operationNotSupported = Operation \"{0}\" not supported by {1} reader. jsp.error.xml.invalidHighSurrogate = High surrogate bits in UTF-8 sequence must not exceed 0x10 but found 0x{0}. jsp.error.xml.invalidASCII = Byte \"{0}\" not 7-bit ASCII. jsp.error.xml.spaceRequiredBeforeEncodingInXMLDecl = White space is required before the encoding pseudo attribute in the XML declaration. jsp.error.xml.spaceRequiredBeforeEncodingInTextDecl = White space is required before the encoding pseudo attribute in the text declaration. jsp.error.xml.spaceRequiredBeforeVersionInTextDecl = White space is required before the version pseudo attribute in the text declaration. jsp.error.xml.spaceRequiredBeforeVersionInXMLDecl = White space is required before the version pseudo attribute in the XML declaration. jsp.error.xml.eqRequiredInXMLDecl = The '' = '' character must follow \"{0}\" in the XML declaration. jsp.error.xml.eqRequiredInTextDecl = The '' = '' character must follow \"{0}\" in the text declaration. jsp.error.xml.quoteRequiredInTextDecl = The value following \"{0}\" in the text declaration must be a quoted string. jsp.error.xml.quoteRequiredInXMLDecl = The value following \"{0}\" in the XML declaration must be a quoted string. jsp.error.xml.invalidCharInTextDecl = An invalid XML character (Unicode: 0x{0}) was found in the text declaration. jsp.error.xml.invalidCharInXMLDecl = An invalid XML character (Unicode: 0x{0}) was found in the XML declaration. jsp.error.xml.closeQuoteMissingInTextDecl = closing quote in the value following \"{0}\" in the text declaration is missing. jsp.error.xml.closeQuoteMissingInXMLDecl = closing quote in the value following \"{0}\" in the XML declaration is missing. jsp.error.multiple.jsp = Cannot have multiple specifications of jsp.error.jspoutput.conflict=<jsp:output>: illegal to have multiple occurrences of \"{0}\" with different values (old: {1}, new: {2}) jsp.error.jspoutput.doctypenamesystem=<jsp:output>: 'doctype-root-element' and 'doctype-system' attributes must appear together jsp.error.jspoutput.doctypepulicsystem=<jsp:output>: 'doctype-system' attribute must appear if 'doctype-public' attribute appears jsp.error.jspoutput.nonemptybody=<jsp:output> must not have a body jsp.error.jspoutput.invalidUse=<jsp:output> must not be used in standard syntax jsp.error.attributes.not.allowed = {0} must not have any attributes jsp.error.tagfile.badSuffix=Missing \".tag\" suffix in tag file path {0} jsp.error.tagfile.illegalPath=Illegal tag file path: {0}, must start with \"/WEB-INF/tags\" or \"/META-INF/tags\" jsp.error.tagfile.missingPath=Path not specified to tag file jsp.error.plugin.wrongRootElement=Name of root element in {0} different from {1} jsp.error.attribute.invalidPrefix=The attribute prefix [{0}] does not correspond to any imported tag library jsp.error.nested.jspattribute=A jsp:attribute standard action cannot be nested within another jsp:attribute standard action jsp.error.nested.jspbody=A jsp:body standard action cannot be nested within another jsp:body or jsp:attribute standard action jsp.error.variable.either.name=Either name-given or name-from-attribute attribute must be specified in a variable directive jsp.error.variable.both.name=Cannot specify both name-given or name-from-attribute attributes in a variable directive jsp.error.variable.alias=Both or none of the name-from-attribute and alias attributes must be specified in a variable directive jsp.error.attribute.null_name=Null attribute name jsp.error.jsptext.badcontent=\'<\', when appears in the body of <jsp:text>, must be encapsulated within a CDATA jsp.error.jsproot.version.invalid=Invalid version number: \"{0}\", must be \"1.2\", \"2.0\", \"2.1\", \"2.2\" or \"2.3\" jsp.error.noFunction=The function {0} cannot be located with the specified prefix jsp.error.noFunctionMethod=Method \"{0}\" for function \"{1}\" not found in class \"{2}\" jsp.error.function.classnotfound=The class {0} specified in TLD for the function {1} cannot be found: {2} jsp.error.signature.classnotfound=The class {0} specified in the method signature in TLD for the function {1} cannot be found. {2} jsp.error.text.has_subelement=<jsp:text> must not have any subelements jsp.error.data.file.read=Error reading file \"{0}\" jsp.error.data.file.processing=Error processing file \"{0}\" jsp.error.prefix.refined=Attempt to redefine the prefix {0} to {1}, when it was already defined as {2} in the current scope. jsp.error.nested_jsproot=Nested <jsp:root> jsp.error.unbalanced.endtag=The end tag \"</{0}\" is unbalanced jsp.error.invalid.bean=The value for the useBean class attribute {0} is invalid. jsp.error.prefix.use_before_dcl=The prefix {0} specified in this tag directive has been previously used by an action in file {1} line {2}. jsp.error.lastModified=Unable to determine last modified date for file [{0}] jsp.exception=An exception occurred processing JSP page {0} at line {1} # JSP 2.1 jsp.error.el.template.deferred=#{...} is not allowed in template text jsp.error.el.parse={0} : {1} jsp.error.page.invalid.deferredsyntaxallowedasliteral=Page directive: invalid value for deferredSyntaxAllowedAsLiteral jsp.error.tag.invalid.deferredsyntaxallowedasliteral=Tag directive: invalid value for deferredSyntaxAllowedAsLiteral jsp.error.page.conflict.deferredsyntaxallowedasliteral=Page directive: illegal to have multiple occurrences of 'deferredSyntaxAllowedAsLiteral' with different values (old: {0}, new: {1}) jsp.error.tag.conflict.deferredsyntaxallowedasliteral=Tag directive: illegal to have multiple occurrences of 'deferredSyntaxAllowedAsLiteral' with different values (old: {0}, new: {1}) jsp.error.page.invalid.trimdirectivewhitespaces=Page directive: invalid value for trimDirectiveWhitespaces jsp.error.tag.invalid.trimdirectivewhitespaces=Tag directive: invalid value for trimDirectiveWhitespaces jsp.error.page.conflict.trimdirectivewhitespaces=Page directive: illegal to have multiple occurrences of 'trimDirectiveWhitespaces' with different values (old: {0}, new: {1}) jsp.error.tag.conflict.trimdirectivewhitespaces=Tag directive: illegal to have multiple occurrences of 'trimDirectiveWhitespaces' with different values (old: {0}, new: {1}) # JSP Servlet jsp.error.servlet.invalid.method=JSPs only permit GET POST or HEAD # JarScanner jsp.warning.noJarScanner=Warning: No org.apache.tomcat.JarScanner set in ServletContext. Falling back to default JarScanner implementation. # JavacErrorDetail jsp.error.bug48498=Unable to display JSP extract. Probably due to an XML parser bug (see Tomcat bug 48498 for details). # UniqueAttributesImpl jsp.error.duplicateqname=An attribute with duplicate qualified name [{0}] was found. Attribute qualified names must be unique within an element. # JSP unloading handling jsp.message.jsp_queue_created=Created jsp queue with length {0} for context [{1}] jsp.message.jsp_added=Adding JSP for path [{0}] to queue of context [{1}] jsp.message.jsp_queue_update=Updating JSP for path [{0}] in queue of context [{1}] jsp.message.jsp_removed_excess=Removing excess JSP for path [{0}] from queue of context [{1}] jsp.message.jsp_removed_idle=Removing idle JSP for path [{0}] in context [{1}] after {2} seconds"); jsp.message.jsp_unload_check=Checking JSPs for unload in context [{0}], JSP count: {1} queue length: {2} xmlParser.skipBomFail=Failed to skip BOM when parsing XML input stream jsp.tldCache.noTldInResourcePath=No TLD files were found in resource path [{0}]. jsp.tldCache.tldInResourcePath=TLD files were found in resource path [{0}]. jsp.tldCache.noTldInDir=No TLD files were found in directory [{0}]. jsp.tldCache.tldInDir=TLD files were found in directory [{0}]. jsp.tldCache.noTldInJar=No TLD files were found in [{0}]. Consider adding the JAR to the tomcat.util.scan.StandardJarScanFilter.jarsToSkip property in CATALINA_BASE/conf/catalina.properties file. jsp.tldCache.tldInJar=TLD files were found in JAR [{0}]. jsp.tldCache.noTldSummary=At least one JAR was scanned for TLDs yet contained no TLDs. Enable debug logging for this logger for a complete list of JARs that were scanned but no TLDs were found in them. Skipping unneeded JARs during scanning can improve startup time and JSP compilation time. #ELInterpreter jsp.error.el_interpreter_class.instantiation=Failed to load or instantiate ELInterpreter class [{0}] org.apache.jasper.compiler.ELParser.invalidQuotesForStringLiteral=The String literal [{0}] is not valid. It must be contained within single or double quotes. org.apache.jasper.compiler.ELParser.invalidQuoting=The expression [{0}] is not valid. Within a quoted String only [\\], [''] and ["] may be escaped with [\\]. org.apache.jasper.compiler.TldCache.servletContextNull=The provided SevletContext was null org.apache.jasper.servlet.JasperInitializer.onStartup=Initializing Jasper for context [{0}] org.apache.jasper.servlet.TldScanner.webxmlSkip=Skipping load of TLD for URI {1} from resource path {0} as it has already been defined in org.apache.jasper.servlet.TldScanner.webxmlAdd=Loading TLD for URI {1} from resource path {0} org.apache.jasper.servlet.TldScanner.webxmlFailPathDoesNotExist=Failed to process TLD with path [{0}] and URI [{1}]. The specified path does not exist.